PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g20490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 163aa    MW: 18518.6 Da    PI: 10.2886
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g20490genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.61.1e-291571158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                +ep+YVNaKQy++Il+RRq Rak+  ++k+  ksrkpylheSRh+hA+rR+R  gGrF
  CA10g20490 15 EEPMYVNAKQYHGILRRRQLRAKAVLQQKV-VKSRKPYLHESRHRHAMRRARDGGGRF 71
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-331374IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.7921474IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-261671IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-221739IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-224871IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MHHNGRMILP IEVKEEPMYV NAKQYHGILR RRQLRAKAVL QQKVVKSRKP YLHESRHRHA  60
MRRARDGGGR FLNTKKNNQH PTNNNNNNAT ASSEGKGGSL VSDSSANYLL NYEQDIGSSN  120
NGEGFQFQGI HGTTKENLQL GCHYQWNLND NNHCNCMHSA HF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-211578265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15564RHRHAMRRAR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543840.11e-118PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP11e-30NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLK4D2F61e-78K4D2F6_SOLLC; Uncharacterized protein
STRINGSolyc10g079150.1.14e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA133921516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.49e-30nuclear factor Y, subunit A1